MIF (NM_002415) Human Recombinant Protein
CAT#: TP305106
Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205106 protein sequence
Red=Cloning site Green=Tags(s) MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002406 |
Locus ID | 4282 |
UniProt ID | P14174 |
Refseq Size | 561 |
Cytogenetics | 22q11.23 |
Refseq ORF | 345 |
Synonyms | GIF; GLIF; MMIF |
Summary | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Phenylalanine metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400864 | MIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400864 | Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
CNY 3,080.00 |
|
PH305106 | MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406) |
CNY 19,520.00 |
|
TP721165 | Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) |
CNY 3,140.00 |