LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein

CAT#: TP305190

Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "LIM domain only 3" proteins (7)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
LMO3 rabbit polyclonal antibody
    • 25 ul

CNY 800.00
CNY 1,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205190 protein sequence
Red=Cloning site Green=Tags(s)

MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL
FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY
APQVR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_061110
Locus ID 55885
UniProt ID Q8TAP4, A0A024RAT1
Refseq Size 3850
Cytogenetics 12p12.3
Refseq ORF 435
Synonyms RBTN3; RBTNL2; Rhom-3; RHOM3
Summary The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...