WIF1 (NM_007191) Human Recombinant Protein
CAT#: TP305256
Recombinant protein of human WNT inhibitory factor 1 (WIF1), 20 µg
View other "WIF1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205256 protein sequence
Red=Cloning site Green=Tags(s) MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC LGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR PAGAQLRQHTPSLKKAEERRDPPESNYIW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009122 |
Locus ID | 11197 |
UniProt ID | Q9Y5W5 |
Refseq Size | 2240 |
Cytogenetics | 12q14.3 |
Refseq ORF | 1137 |
Synonyms | WIF-1 |
Summary | The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers. [provided by RefSeq, Jun 2010] |
Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Wnt signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Wnt Signaling Drives Prostate Cancer Bone Metastatic Tropism and Invasion
,null,
Translational Oncology
,PubMed ID 32217460
[WIF1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402102 | WIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402102 | Transient overexpression lysate of WNT inhibitory factor 1 (WIF1) |
CNY 3,080.00 |
|
PH305256 | WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122) |
CNY 19,520.00 |
|
TP720656 | Purified recombinant protein of Human WNT inhibitory factor 1 (WIF1) |
CNY 3,140.00 |