VPS26 (VPS26A) (NM_004896) Human Recombinant Protein
CAT#: TP305353
Recombinant protein of human vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1, 20 µg
View other "VPS26" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205353 protein sequence
Red=Cloning site Green=Tags(s) MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRI EFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRL TDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQ LIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD EEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004887 |
Locus ID | 9559 |
UniProt ID | O75436 |
Refseq Size | 2707 |
Cytogenetics | 10q22.1 |
Refseq ORF | 981 |
Synonyms | HB58; Hbeta58; PEP8A; VPS26 |
Summary | This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401527 | VPS26A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422131 | VPS26A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401527 | Transient overexpression lysate of vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 1 |
CNY 3,080.00 |
|
LY422131 | Transient overexpression lysate of vacuolar protein sorting 26 homolog A (S. pombe) (VPS26A), transcript variant 2 |
CNY 3,080.00 |
|
PH305353 | VPS26A MS Standard C13 and N15-labeled recombinant protein (NP_004887) |
CNY 19,520.00 |