BCAS2 (NM_005872) Human Recombinant Protein
CAT#: TP305615
Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2), 20 µg
View other "BCAS2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205615 protein sequence
Red=Cloning site Green=Tags(s) MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK QQHGEANKENIRQDF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005863 |
Locus ID | 10286 |
UniProt ID | O75934 |
Refseq Size | 1310 |
Cytogenetics | 1p13.2 |
Refseq ORF | 675 |
Synonyms | DAM1; Snt309; SPF27 |
Summary | Required for pre-mRNA splicing as component of the activated spliceosome (PubMed:28502770, PubMed:28076346, PubMed:29360106, PubMed:29301961, PubMed:30705154). Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417014 | BCAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417014 | Transient overexpression lysate of breast carcinoma amplified sequence 2 (BCAS2) |
CNY 3,080.00 |
|
PH305615 | BCAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005863) |
CNY 19,520.00 |
|
TP720563 | Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2) |
CNY 3,140.00 |