United States
Germany
Japan
United Kingdom
China
Ribonuclease A (RNASE1) (NM_198235) Human Recombinant Protein
CAT＃: TP305620
Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 20 µg
View other "Ribonuclease A" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205620 protein sequence
Red=Cloning site Green=Tags(s) MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG SPYVPVHFDASVEDST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_937878 |
| Locus ID | 6035 |
| UniProt ID | P07998 |
| Refseq Size | 903 |
| Cytogenetics | 14q11.2 |
| Refseq ORF | 468 |
| Synonyms | RAC1; RIB1; RNS1 |
| Summary | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401024 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404956 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404957 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404958 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401024 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 |
CNY 3,080.00 |
|
| LY404956 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3 |
CNY 3,080.00 |
|
| LY404957 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2 |
CNY 3,080.00 |
|
| LY404958 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1 |
CNY 3,080.00 |
|
| PH305620 | RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) |
CNY 19,520.00 |
|
| TP720748 | Purified recombinant protein of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 |
CNY 3,140.00 |
其它Ribonuclease A产品
