ERp57 (PDIA3) (NM_005313) Human Recombinant Protein
CAT#: TP305940
Recombinant protein of human protein disulfide isomerase family A, member 3 (PDIA3), 20 µg
View other "ERp57" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205940 representing NM_005313
Red=Cloning site Green=Tags(s) MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI QEEKPKKKKKAQEDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005304 |
Locus ID | 2923 |
UniProt ID | P30101 |
Refseq Size | 3060 |
Cytogenetics | 15q15.3 |
Refseq ORF | 1515 |
Synonyms | ER60; ERp57; ERp60; ERp61; GRP57; GRP58; HEL-S-93n; HEL-S-269; HsT17083; P58; PI-PLC |
Summary | This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Antigen processing and presentation |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Protein disulfide isomerase plasma levels in healthy humans reveal proteomic signatures involved in contrasting endothelial phenotypes
,de Oliveira, PVS;Garcia-Rosa, S;Sachetto, ATA;,
Redox Biology
,PubMed ID 30870787
[PDIA3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401637 | PDIA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401637 | Transient overexpression lysate of protein disulfide isomerase family A, member 3 (PDIA3) |
CNY 3,080.00 |
|
PH305940 | PDIA3 MS Standard C13 and N15-labeled recombinant protein (NP_005304) |
CNY 19,520.00 |
|
TP721117 | Purified recombinant protein of Human protein disulfide isomerase family A, member 3 (PDIA3 |
CNY 1,800.00 |