C14orf142 (GON7) (NM_032490) Human Recombinant Protein
CAT#: TP306178L
Recombinant protein of human chromosome 14 open reading frame 142 (C14orf142), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206178 protein sequence
Red=Cloning site Green=Tags(s) MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDG DDEDDAEDENNIDNRTNFDGPSAKRPKTPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115879 |
Locus ID | 84520 |
UniProt ID | Q9BXV9 |
Refseq Size | 1191 |
Cytogenetics | 14q32.12 |
Refseq ORF | 300 |
Synonyms | C14orf142; PNAS-127 |
Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它C14orf142产品