JMJD5 (KDM8) (NM_024773) Human Recombinant Protein
CAT#: TP306417
Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 2, 20 µg
View other "JMJD5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206417 protein sequence
Red=Cloning site Green=Tags(s) MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGRRDECLQSSEV ILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLK VAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKG VADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFD QIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079049 |
Locus ID | 79831 |
UniProt ID | Q8N371 |
Refseq Size | 2481 |
Cytogenetics | 16p12.1 |
Refseq ORF | 1248 |
Synonyms | JMJD5 |
Summary | This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403027 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428835 | KDM8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403027 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 2 |
CNY 3,080.00 |
|
LY428835 | Transient overexpression lysate of jumonji domain containing 5 (JMJD5), transcript variant 1 |
CNY 3,080.00 |
|
PH306417 | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_079049) |
CNY 19,520.00 |
|
PH327709 | JMJD5 MS Standard C13 and N15-labeled recombinant protein (NP_001138820) |
CNY 19,520.00 |
|
TP327709 | Recombinant protein of human jumonji domain containing 5 (JMJD5), transcript variant 1, 20 µg |
CNY 2,900.00 |