Myocilin (MYOC) (NM_000261) Human Recombinant Protein
CAT#: TP306556
Recombinant protein of human myocilin, trabecular meshwork inducible glucocorticoid response (MYOC), 20 µg
View other "Myocilin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206556 representing NM_000261
Red=Cloning site Green=Tags(s) MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSV IHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLETQTRELET AYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTL AFQELKSELTEVPASRILKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPY TQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELN TETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWD NLNMVTYDIKLSKM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000252 |
Locus ID | 4653 |
UniProt ID | Q99972, A0A0S2Z421 |
Refseq Size | 2061 |
Cytogenetics | 1q24.3 |
Refseq ORF | 1512 |
Synonyms | GLC1A; GPOA; JOAG; JOAG1; TIGR |
Summary | MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Full-length myocilin protein is purified from mammalian cells as a dimer.
,null,
Protein expression and purification
,PubMed ID 29475084
[MYOC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424839 | MYOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424839 | Transient overexpression lysate of myocilin, trabecular meshwork inducible glucocorticoid response (MYOC) |
CNY 3,080.00 |
|
PH306556 | MYOC MS Standard C13 and N15-labeled recombinant protein (NP_000252) |
CNY 19,520.00 |
其它Myocilin产品