PHLDA3 (NM_012396) Human Recombinant Protein
CAT#: TP306751
Recombinant protein of human pleckstrin homology-like domain, family A, member 3 (PHLDA3), 20 µg
View other "PHLDA3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206751 protein sequence
Red=Cloning site Green=Tags(s) MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036528 |
Locus ID | 23612 |
UniProt ID | Q9Y5J5 |
Refseq Size | 1516 |
Cytogenetics | 1q32.1 |
Refseq ORF | 381 |
Synonyms | TIH1 |
Summary | p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415793 | PHLDA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415793 | Transient overexpression lysate of pleckstrin homology-like domain, family A, member 3 (PHLDA3) |
CNY 3,080.00 |
|
PH306751 | PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528) |
CNY 19,520.00 |