TORC1 (CRTC1) (NM_015321) Human Recombinant Protein
CAT#: TP306974
Recombinant protein of human CREB regulated transcription coactivator 1 (CRTC1), transcript variant 1, 20 µg
View other "TORC1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206974 representing NM_015321
Red=Cloning site Green=Tags(s) MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ IGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSP PADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTG SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGN LAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARRQQASPALSPLSPITQAVAMDALSLEQQL PYAFFTQAGSQQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYE QQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGSHGSLPDSQQLGYASHSGIPN IILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFR MDRL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 67.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056136 |
Locus ID | 23373 |
UniProt ID | Q6UUV9 |
Refseq Size | 2505 |
Cytogenetics | 19p13.11 |
Refseq ORF | 1902 |
Synonyms | Mam-2; MAML2; MECT1; TORC-1; TORC1; WAMTP1 |
Summary | Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons (By similarity). In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414618 | CRTC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420588 | CRTC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY414618 | Transient overexpression lysate of CREB regulated transcription coactivator 1 (CRTC1), transcript variant 1 |
CNY 3,080.00 |
|
LY420588 | Transient overexpression lysate of CREB regulated transcription coactivator 1 (CRTC1), transcript variant 3 |
CNY 4,840.00 |
|
PH306974 | CRTC1 MS Standard C13 and N15-labeled recombinant protein (NP_056136) |
CNY 19,520.00 |
|
PH324693 | CRTC1 MS Standard C13 and N15-labeled recombinant protein (NP_001091952) |
CNY 14,250.00 |
|
TP324693 | Recombinant protein of human CREB regulated transcription coactivator 1 (CRTC1), transcript variant 3, 20 µg |
CNY 2,900.00 |