AHSP (NM_016633) Human Recombinant Protein
CAT#: TP307743
Recombinant protein of human erythroid associated factor (ERAF), 20 µg
View other "AHSP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207743 protein sequence
Red=Cloning site Green=Tags(s) MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL RQELNTLANPFLAKYRDFLKSHELPSHPPPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057717 |
Locus ID | 51327 |
UniProt ID | Q9NZD4, Q549J4 |
Refseq Size | 518 |
Cytogenetics | 16p11.2 |
Refseq ORF | 306 |
Synonyms | EDRF; ERAF |
Summary | This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413883 | AHSP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413883 | Transient overexpression lysate of alpha hemoglobin stabilizing protein (AHSP) |
CNY 3,080.00 |
|
PH307743 | AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717) |
CNY 19,520.00 |