TBX21 (NM_013351) Human Recombinant Protein
CAT#: TP307902
Recombinant protein of human T-box 21 (TBX21), 20 µg
View other "TBX21" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207902 representing NM_013351
Red=Cloning site Green=Tags(s) MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSR FLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVA LNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKA EGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEP EAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFL GGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDS GLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 30054205) |
Reference Data | |
RefSeq | NP_037483 |
Locus ID | 30009 |
UniProt ID | Q9UL17 |
Refseq Size | 2589 |
Cytogenetics | 17q21.32 |
Refseq ORF | 1605 |
Synonyms | T-bet; T-PET; TBET; TBLYM |
Summary | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
PD-1 Inhibitory Receptor Downregulates Asparaginyl Endopeptidase and Maintains Foxp3 Transcription Factor Stability in Induced Regulatory T Cells
,Stathopoulou, C;Gangaplara, A;Mallett, G;Flomerfelt, FA;Liniany, LP;Knight, D;Samsel, LA;Berlinguer-Palmini, R;Yim, JJ;Felizardo, TC;Eckhaus, MA;Edgington-Mitchell, L;Martinez-Fabregas, J;Zhu, J;Fowler, DH;van Kasteren, SI;Laurence, A;Bogyo, M;Watts, C;Shevach, EM;Amarnath, S;,
Immunity
,PubMed ID 30054205
[TBX21]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |