COMMD7 (NM_053041) Human Recombinant Protein
CAT#: TP307984
Recombinant protein of human COMM domain containing 7 (COMMD7), transcript variant 1, 20 µg
View other "COMMD7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207984 protein sequence
Red=Cloning site Green=Tags(s) MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEQKEVERFLAQLSEFATTNQISLGSLRS IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNTPTLARWAIGQTLMINQLIDMEWK FGVTSGSSELEKVGSIFLQLKLVVKKGNQTKNVYIELTLPQFYSFLHEMERVRTSMECFC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444269 |
Locus ID | 149951 |
UniProt ID | Q86VX2 |
Refseq Size | 1928 |
Cytogenetics | 20q11.21 |
Refseq ORF | 600 |
Synonyms | C20orf92; dJ1085F17.3 |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409337 | COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420436 | COMMD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409337 | Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 1 |
CNY 3,080.00 |
|
LY420436 | Transient overexpression lysate of COMM domain containing 7 (COMMD7), transcript variant 2 |
CNY 3,080.00 |
|
PH307984 | COMMD7 MS Standard C13 and N15-labeled recombinant protein (NP_444269) |
CNY 19,520.00 |