COMMD7 (NM_053041) Human Recombinant Protein

CAT#: TP307984L

Recombinant protein of human COMM domain containing 7 (COMMD7), transcript variant 1, 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36,000.00


货期*
4周

规格
    • 1 mg

Product images

经常一起买 (2)
Rabbit Polyclonal COMMD7 Antibody
    • 100 ug

CNY 5,808.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC207984 protein sequence
Red=Cloning site Green=Tags(s)

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEQKEVERFLAQLSEFATTNQISLGSLRS
IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNTPTLARWAIGQTLMINQLIDMEWK
FGVTSGSSELEKVGSIFLQLKLVVKKGNQTKNVYIELTLPQFYSFLHEMERVRTSMECFC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_444269
Locus ID 149951
UniProt ID Q86VX2
Refseq Size 1928
Cytogenetics 20q11.21
Refseq ORF 600
Synonyms C20orf92; dJ1085F17.3
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Associates with the NF-kappa-B complex and suppresses its transcriptional activity (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...