AMH (NM_000479) Human Recombinant Protein
CAT#: TP308397
Recombinant protein of human anti-Mullerian hormone (AMH), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208397 representing NM_000479
Red=Cloning site Green=Tags(s) MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPL RVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAWLRDPGGQRLVVLHLEEVTW EPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGS GLALTLQPRGEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAEL EESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLL RPTAATTGDPAPLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQG VCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vivo treatment (PMID: 29760445) |
Reference Data | |
RefSeq | NP_000470 |
Locus ID | 268 |
UniProt ID | P03971 |
Refseq Size | 2008 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1680 |
Synonyms | MIF; MIS |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Elevated prenatal anti-Müllerian hormone reprograms the fetus and induces polycystic ovary syndrome in adulthood
,Tata, B;Mimouni, NEH;Barbotin, AL;Malone, SA;Loyens, A;Pigny, P;Dewailly, D;Catteau-Jonard, S;Sundström-Poromaa, I;Piltonen, TT;Dal Bello, F;Medana, C;Prevot, V;Clasadonte, J;Giacobini, P;,
Nat. Med.
,PubMed ID 29760445
[AMH]
|
Anti-mullerian hormone is expressed by endometriosis tissues and induces cell cycle arrest and apoptosis in endometriosis cells
,Signorile, PG;Petraglia, F;Baldi, A;,
J. Exp. Clin. Cancer Res.
,PubMed ID 24886254
[AMH]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424689 | AMH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424689 | Transient overexpression lysate of anti-Mullerian hormone (AMH) |
CNY 3,080.00 |
|
PH308397 | AMH MS Standard C13 and N15-labeled recombinant protein (NP_000470) |
CNY 19,520.00 |
|
TP700250 | Purified recombinant protein of secreted human anti-Mullerian hormone (AMH), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP701045 | Purified recombinant protein of Human anti-Mullerian hormone (AMH), with C-terminal His tag, secretory expressed in CHO cells, 20ug |
CNY 7,106.00 |