United States
Germany
Japan
United Kingdom
China
SRC (NM_005417) Human Recombinant Protein
CAT＃: TP308622
Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 3 publications. |
Product images
热销推荐CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208622 representing NM_005417
Red=Cloning site Green=Tags(s) MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005408 |
| Locus ID | 6714 |
| UniProt ID | P12931 |
| Refseq Size | 4145 |
| Cytogenetics | 20q11.23 |
| Refseq ORF | 1608 |
| Synonyms | ASV; c-SRC; p60-Src; SRC1; THC6 |
| Summary | This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Stem cell relevant signaling - JAK/STAT signaling pathway |
| Protein Pathways | Adherens junction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, GnRH signaling pathway, Tight junction, VEGF signaling pathway |
Citations (3)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Glycogen Synthase Kinase 3β Regulates Antiviral Responses of TLR3 via TRAF2-Src Axis.
,null,
Journal of immunology (Baltimore, Md. : 1950)
,PubMed ID 31619538
[SRC]
|
|
Two novel ligand-independent variants of the VEGFR-1 receptor are expressed in human testis and spermatozoa, one of them with the ability to activate SRC proto-oncogene tyrosine kinases
,null,
Oncotarget
,PubMed ID 31645906
[SRC]
|
|
JNK mediates mouse liver injury through a novel Sab (SH3BP5) dependent pathway leading to inactivation of intramitochondrial Src
,null,
Hepatology (Baltimore, Md.)
,PubMed ID 26845758
[SRC]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405010 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417311 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405010 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2 |
CNY 3,080.00 |
|
| LY417311 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1 |
CNY 3,080.00 |
|
| PH308622 | SRC MS Standard C13 and N15-labeled recombinant protein (NP_005408) |
CNY 19,520.00 |
|
| PH311858 | SRC MS Standard C13 and N15-labeled recombinant protein (NP_938033) |
CNY 19,520.00 |
|
| TP311858 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP710015 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), with N-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4,020.00 |
|
| TP710026 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC),with C-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4,020.00 |
