HS3ST1 (NM_005114) Human Recombinant Protein
CAT#: TP309256
Recombinant protein of human heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1), 20 µg
View other "HS3ST1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209256 protein sequence
Red=Cloning site Green=Tags(s) MAALLLGAVLLVAQPQLVPSRTAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRAL LEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSI RLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLR HIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPK LLNKLHEYFHEPNKKFFELVGRTFDWH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005105 |
Locus ID | 9957 |
UniProt ID | O14792, A0A024R9R4 |
Refseq Size | 1965 |
Cytogenetics | 4p15.33 |
Refseq ORF | 921 |
Synonyms | 3OST; 3OST1 |
Summary | Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Heparan sulfate biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417504 | HS3ST1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417504 | Transient overexpression lysate of heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1) |
CNY 3,080.00 |
|
PH309256 | HS3ST1 MS Standard C13 and N15-labeled recombinant protein (NP_005105) |
CNY 19,520.00 |