COMMD5 (NM_014066) Human Recombinant Protein
CAT#: TP309381
Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg
View other "COMMD5" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209381 protein sequence
Red=Cloning site Green=Tags(s) MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE MADLEKRCERRLQD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054785 |
Locus ID | 28991 |
UniProt ID | Q9GZQ3 |
Refseq Size | 1475 |
Cytogenetics | 8q24.3 |
Refseq ORF | 672 |
Synonyms | HCARG; HT002 |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415491 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421149 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421150 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415491 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 |
CNY 3,080.00 |
|
LY421149 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 |
CNY 3,080.00 |
|
LY421150 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 |
CNY 3,080.00 |
|
PH301051 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473) |
CNY 19,520.00 |
|
PH309381 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) |
CNY 19,520.00 |
|
PH316768 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) |
CNY 19,520.00 |
|
TP301051 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP316768 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg |
CNY 2,900.00 |