United States
Germany
Japan
United Kingdom
China
COMMD5 (NM_001081003) Human Recombinant Protein
CAT＃: TP316768
Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg
View other "COMMD5" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216768 protein sequence
Red=Cloning site Green=Tags(s) MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE MADLEKRCERRLQD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001074472 |
| Locus ID | 28991 |
| UniProt ID | Q9GZQ3 |
| Refseq Size | 1453 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 672 |
| Synonyms | HCARG; HT002 |
| Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415491 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421149 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421150 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415491 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 |
CNY 3,080.00 |
|
| LY421149 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 |
CNY 3,080.00 |
|
| LY421150 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 |
CNY 3,080.00 |
|
| PH301051 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473) |
CNY 19,520.00 |
|
| PH309381 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) |
CNY 19,520.00 |
|
| PH316768 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) |
CNY 19,520.00 |
|
| TP301051 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP309381 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg |
CNY 2,900.00 |
