Glutathione Reductase (GSR) (NM_000637) Human Recombinant Protein
CAT#: TP309652
Recombinant protein of human glutathione reductase (GSR), 20 µg
View other "Glutathione Reductase" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209652 protein sequence
Red=Cloning site Green=Tags(s) MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAGAVASYDYLVI GGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNW RVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHES QIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTE ELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQ TDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQG FAVAVKMGATKADFDNTVAIHPTSSEELVTLR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000628 |
Locus ID | 2936 |
UniProt ID | P00390 |
Refseq Size | 3174 |
Cytogenetics | 8p12 |
Refseq ORF | 1566 |
Synonyms | GR; GSRD; HEL-75; HEL-S-122m |
Summary | This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Glutathione metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424558 | GSR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434254 | GSR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424558 | Transient overexpression lysate of glutathione reductase (GSR) |
CNY 3,080.00 |
|
LY434254 | Transient overexpression lysate of glutathione reductase (GSR), transcript variant 3 |
CNY 3,080.00 |
|
PH309652 | GSR MS Standard C13 and N15-labeled recombinant protein (NP_000628) |
CNY 14,250.00 |
其它Glutathione Reductase产品