DNAJC19 (NM_145261) Human Recombinant Protein
CAT#: TP309910
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), 20 µg
View other "DNAJC19" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209910 protein sequence
Red=Cloning site Green=Tags(s) MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660304 |
Locus ID | 131118 |
UniProt ID | Q96DA6, A0A0S2Z5X1 |
Refseq Size | 1476 |
Cytogenetics | 3q26.33 |
Refseq ORF | 348 |
Synonyms | PAM18; TIM14; TIMM14 |
Summary | The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407987 | DNAJC19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407987 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19) |
CNY 3,080.00 |
|
PH309910 | DNAJC19 MS Standard C13 and N15-labeled recombinant protein (NP_660304) |
CNY 19,520.00 |
其它DNAJC19产品