Pepsinogen II (PGC) (NM_002630) Human Recombinant Protein
CAT#: TP310051
Recombinant protein of human progastricsin (pepsinogen C) (PGC), 20 µg
View other "Pepsinogen II" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210051 protein sequence
Red=Cloning site Green=Tags(s) MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD AAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLT GFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF SVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTS LLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPT YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002621 |
Locus ID | 5225 |
UniProt ID | P20142 |
Refseq Size | 1392 |
Cytogenetics | 6p21.1 |
Refseq ORF | 1164 |
Synonyms | PEPC; PGII |
Summary | This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009] |
Protein Families | Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419201 | PGC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432872 | PGC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419201 | Transient overexpression lysate of progastricsin (pepsinogen C) (PGC), transcript variant 1 |
CNY 3,080.00 |
|
LY432872 | Transient overexpression lysate of progastricsin (pepsinogen C) (PGC), transcript variant 2 |
CNY 3,080.00 |
|
PH310051 | PGC MS Standard C13 and N15-labeled recombinant protein (NP_002621) |
CNY 19,520.00 |
其它Pepsinogen II产品