LECT2 (NM_002302) Human Recombinant Protein
CAT#: TP310790
Recombinant protein of human leukocyte cell-derived chemotaxin 2 (LECT2), 20 µg
View other "LECT2" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210790 protein sequence
Red=Cloning site Green=Tags(s) MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE NCDSSDPTAYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 26123523) |
Reference Data | |
RefSeq | NP_002293 |
Locus ID | 3950 |
UniProt ID | O14960 |
Refseq Size | 1077 |
Cytogenetics | 5q31.1 |
Refseq ORF | 453 |
Synonyms | chm-II; chm2 |
Summary | This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
LECT2 induces atherosclerotic inflammatory reaction via CD209 receptor-mediated JNK phosphorylation in human endothelial cells
,Hwang, HJ;Jung, TW;Hong, HC;Seo, JA;Kim, SG;Kim, NH;Choi, KM;Choi, DS;Baik, SH;Yoo, HJ;,
Metab. Clin. Exp.
,PubMed ID 26123523
[LECT2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |