TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein
CAT#: TP310926
Recombinant protein of human radial spoke head 1 homolog (Chlamydomonas) (RSPH1), 20 µg
View other "TSGA2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210926 protein sequence
Red=Cloning site Green=Tags(s) MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGE YVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGT WVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWK ATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESRE YDQEEFRYDMDEGNINSEEEETRQSDLQD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_543136 |
Locus ID | 89765 |
UniProt ID | Q8WYR4 |
Refseq Size | 1445 |
Cytogenetics | 21q22.3 |
Refseq ORF | 927 |
Synonyms | CT79; RSP44; RSPH10A; TSA2; TSGA2 |
Summary | This gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409012 | RSPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409012 | Transient overexpression lysate of radial spoke head 1 homolog (Chlamydomonas) (RSPH1) |
CNY 3,080.00 |
|
PH310926 | RSPH1 MS Standard C13 and N15-labeled recombinant protein (NP_543136) |
CNY 19,520.00 |