Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Recombinant Protein
CAT#: TP311299
Recombinant protein of human casein kinase 2, beta polypeptide (CSNK2B), 20 µg
View other "Casein Kinase 2 beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211299 protein sequence
Red=Cloning site Green=Tags(s) MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP VKTIR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001311 |
Locus ID | 1460 |
UniProt ID | P67870 |
Refseq Size | 1149 |
Cytogenetics | 6p21.33 |
Refseq ORF | 645 |
Synonyms | CK2B; CK2N; Ckb1; Ckb2; CSK2B; G5A; POBINDS |
Summary | This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Tight junction, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400525 | CSNK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400525 | Transient overexpression lysate of casein kinase 2, beta polypeptide (CSNK2B) |
CNY 3,080.00 |
|
PH311299 | CSNK2B MS Standard C13 and N15-labeled recombinant protein (NP_001311) |
CNY 19,520.00 |
其它Casein Kinase 2 beta产品