Nudel (NDEL1) (NM_001025579) Human Recombinant Protein
CAT#: TP312323
Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1, 20 µg
View other "Nudel" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212323 representing NM_001025579
Red=Cloning site Green=Tags(s) MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGQEKVIFPTLFMGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020750 |
Locus ID | 81565 |
UniProt ID | Q9GZM8 |
Refseq Size | 2420 |
Cytogenetics | 17p13.1 |
Refseq ORF | 984 |
Synonyms | EOPA; MITAP1; NDE1L1; NDE2; NUDEL |
Summary | This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410703 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422448 | NDEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410703 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2 |
CNY 3,080.00 |
|
LY422448 | Transient overexpression lysate of nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 1 |
CNY 3,080.00 |
|
PH305974 | NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_110435) |
CNY 19,520.00 |
|
PH312323 | NDEL1 MS Standard C13 and N15-labeled recombinant protein (NP_001020750) |
CNY 19,520.00 |
|
TP305974 | Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2, 20 µg |
CNY 2,900.00 |