Carbonic anhydrase X (CA10) (NM_001082534) Human Recombinant Protein
CAT#: TP312539
Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 3, 20 µg
View other "Carbonic anhydrase X" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212539 protein sequence
Red=Cloning site Green=Tags(s) MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001076003 |
Locus ID | 56934 |
UniProt ID | Q9NS85, A0A384MTY8 |
Refseq Size | 2951 |
Cytogenetics | 17q21.33-q22 |
Refseq ORF | 984 |
Synonyms | CA-RPX; CARPX; HUCEP-15 |
Summary | This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412601 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421186 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421187 | CA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412601 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 2 |
CNY 3,080.00 |
|
LY421186 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 1 |
CNY 3,080.00 |
|
LY421187 | Transient overexpression lysate of carbonic anhydrase X (CA10), transcript variant 3 |
CNY 3,080.00 |
|
PH309723 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076002) |
CNY 19,520.00 |
|
PH312539 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_001076003) |
CNY 19,520.00 |
|
PH313425 | CA10 MS Standard C13 and N15-labeled recombinant protein (NP_064563) |
CNY 19,520.00 |
|
TP309723 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP313425 | Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720625 | Purified recombinant protein of Human carbonic anhydrase X (CA10), transcript variant 1 |
CNY 3,140.00 |
其它Carbonic anhydrase X产品