MEF2A (NM_005587) Human Recombinant Protein
CAT#: TP312830
Recombinant protein of human myocyte enhancer factor 2A (MEF2A), transcript variant 1, 20 µg
View other "MEF2A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212830 representing NM_005587
Red=Cloning site Green=Tags(s) MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPS SKGMMPPLNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGM LSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQQQQQQQ QQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVK RMRMDAWVT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 53.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005578 |
Locus ID | 4205 |
UniProt ID | Q02078, A0A0S2Z4N0, A0A0S2Z454 |
Refseq Size | 2975 |
Cytogenetics | 15q26.3 |
Refseq ORF | 1497 |
Synonyms | ADCAD1; mef2; RSRFC4; RSRFC9 |
Summary | The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular processes, including muscle development, neuronal differentiation, cell growth control, and apoptosis. Defects in this gene could be a cause of autosomal dominant coronary artery disease 1 with myocardial infarction (ADCAD1). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401713 | MEF2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427317 | MEF2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401713 | Transient overexpression lysate of myocyte enhancer factor 2A (MEF2A), transcript variant 1 |
CNY 4,840.00 |
|
LY427317 | Transient overexpression lysate of myocyte enhancer factor 2A (MEF2A), transcript variant 3 |
CNY 3,080.00 |
|
PH312830 | MEF2A MS Standard C13 and N15-labeled recombinant protein (NP_005578) |
CNY 19,520.00 |