HSD17B13 (NM_178135) Human Recombinant Protein
CAT#: TP313132
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 20 µg
View other "HSD17B13" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
Cited in 2 publications. |
CNY 1,999.00
CNY 4,066.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213132 protein sequence
Red=Cloning site Green=Tags(s) MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI LNRMQNIQFEAVVGHKIKMK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_835236 |
Locus ID | 345275 |
UniProt ID | Q7Z5P4 |
Refseq Size | 2397 |
Cytogenetics | 4q22.1 |
Refseq ORF | 900 |
Synonyms | HMFN0376; NIIL497; SCDR9; SDR16C3 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Discovery of a Novel Potent and Selective HSD17B13 Inhibitor, BI-3231, a Well-Characterized Chemical Probe Available for Open Science
,null,
Journal of Medicinal Chemistry
,PubMed ID 36727857
[HSD17B13]
|
Genome-wide association study of non-alcoholic fatty liver and steatohepatitis in a histologically-characterised cohort
,Anstee, QM;Darlay, R;Cockell, S;Meroni, M;Govaere, O;Tiniakos, D;Burt, AD;Bedossa, P;Palmer, J;Liu, YL;Aithal, GP;Allison, M;Yki-Järvinen, H;Vacca, M;Dufour, JF;Invernizzi, P;Prati, D;Ekstedt, M;Kechagias, S;Francque, S;Petta, S;Bugianesi, E;Clement, K;Ratziu, V;Schattenberg, JM;Valenti, L;Day, CP;Cordell, HJ;Daly, AK;, ;,
J. Hepatol.
,PubMed ID 32298765
[HSD17B13]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405941 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427863 | HSD17B13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC440268 | HSD17B13, transcript variant D, HEK 293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC440269 | HSD17B13, transcript variant C, HEK 293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405941 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A |
CNY 3,080.00 |
|
LY427863 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant B |
CNY 3,080.00 |
|
LY440268 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant D |
CNY 2,990.00 |
|
LY440269 | Transient overexpression lysate of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant C |
CNY 2,990.00 |
|
PH313132 | HSD17B13 MS Standard C13 and N15-labeled recombinant protein (NP_835236) |
CNY 19,520.00 |
其它HSD17B13产品