PTPN18 (NM_014369) Human Recombinant Protein
CAT#: TP313476
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 18 (brain-derived) (PTPN18), transcript variant 1, 20 µg
View other "PTPN18" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213476 representing NM_014369
Red=Cloning site Green=Tags(s) MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQ TRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKR CERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAM VEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQ YRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAM ADTYAVVQKRGAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055184 |
Locus ID | 26469 |
UniProt ID | Q99952 |
Refseq Size | 2837 |
Cytogenetics | 2q21.1 |
Refseq ORF | 1380 |
Synonyms | BDP1; PTP-HSCF |
Summary | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, the mitotic cycle, and oncogenic transformation. This PTP contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This protein can differentially dephosphorylate autophosphorylated tyrosine kinases that are overexpressed in tumor tissues, and it appears to regulate HER2, a member of the epidermal growth factor receptor family of receptor tyrosine kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415333 | PTPN18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428059 | PTPN18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415333 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 18 (brain-derived) (PTPN18), transcript variant 1 |
CNY 4,840.00 |
|
LY428059 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 18 (brain-derived) (PTPN18), transcript variant 2 |
CNY 3,080.00 |
|
PH313476 | PTPN18 MS Standard C13 and N15-labeled recombinant protein (NP_055184) |
CNY 14,250.00 |