Tryptophanyl tRNA synthetase (WARS) (NM_173701) Human Recombinant Protein
CAT#: TP313605
Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 2, 20 µg
View other "Tryptophanyl tRNA synthetase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213605 protein sequence
Red=Cloning site Green=Tags(s) MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776049 |
Locus ID | 7453 |
UniProt ID | P23381 |
Refseq Size | 2660 |
Cytogenetics | 14q32.2 |
Refseq ORF | 1413 |
Synonyms | GAMMA-2; HMN9; IFI53; IFP53; WARS |
Summary | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401346 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406568 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401346 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 1 |
CNY 3,080.00 |
|
LY406568 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 2 |
CNY 4,840.00 |
|
PH313605 | WARS MS Standard C13 and N15-labeled recombinant protein (NP_776049) |
CNY 19,520.00 |
|
TP720622 | Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1 |
CNY 1,800.00 |
|
TP760112 | Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Tryptophanyl tRNA synthetase产品