Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein
CAT#: TP313652
Recombinant protein of human epsin 2 (EPN2), transcript variant 2, 20 µg
View other "Epsin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213652 representing NM_014964
Red=Cloning site Green=Tags(s) MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASS AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA QATGTTNPFLL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 68.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055779 |
Locus ID | 22905 |
UniProt ID | O95208 |
Refseq Size | 4814 |
Cytogenetics | 17p11.2 |
Refseq ORF | 1923 |
Synonyms | EHB21 |
Summary | This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407732 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420185 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407732 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 1 |
CNY 3,080.00 |
|
LY420185 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 3 |
CNY 3,080.00 |
|
PH310899 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_683723) |
CNY 19,520.00 |
|
PH313652 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_055779) |
CNY 19,520.00 |
|
TP310899 | Recombinant protein of human epsin 2 (EPN2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Epsin 2产品