SLC39A7 (NM_001077516) Human Recombinant Protein
CAT#: TP313722
Recombinant protein of human solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 2, 20 µg
View other "SLC39A7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213722 protein sequence
Red=Cloning site Green=Tags(s) MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHES IWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALG ATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSH SGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEE KETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001070984 |
Locus ID | 7922 |
UniProt ID | Q92504, A0A024RCX7 |
Refseq Size | 2172 |
Cytogenetics | 6p21.32 |
Refseq ORF | 1407 |
Synonyms | D6S115E; D6S2244E; H2-KE4; HKE4; KE4; RING5; ZIP7 |
Summary | The protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416296 | SLC39A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421455 | SLC39A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416296 | Transient overexpression lysate of solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 1 |
CNY 3,080.00 |
|
LY421455 | Transient overexpression lysate of solute carrier family 39 (zinc transporter), member 7 (SLC39A7), transcript variant 2 |
CNY 4,840.00 |
|
PH313722 | SLC39A7 MS Standard C13 and N15-labeled recombinant protein (NP_001070984) |
CNY 19,520.00 |
其它SLC39A7产品