FGR (NM_005248) Human Recombinant Protein
CAT#: TP314458
Recombinant protein of human Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214458 representing NM_005248
Red=Cloning site Green=Tags(s) MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGT IRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQ AEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYI TTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLG TWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPE GQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEA MEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | FGR activity verified in a biochemical assay: FGR (Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog) (TP314458) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. FGR is a tyrosine kinase that is a member of the Src family of protein tyrosine kinases. Varying concentrations of FGR were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Reference Data | |
RefSeq | NP_005239 |
Locus ID | 2268 |
UniProt ID | P09769 |
Refseq Size | 2354 |
Cytogenetics | 1p35.3 |
Refseq ORF | 1587 |
Synonyms | c-fgr; c-src2; p55-Fgr; p55c-fgr; p58-Fgr; p58c-fgr; SRC2 |
Summary | This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401612 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420800 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420802 | FGR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401612 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 1 |
CNY 3,080.00 |
|
LY420800 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 3 |
CNY 3,080.00 |
|
LY420802 | Transient overexpression lysate of Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 2 |
CNY 4,840.00 |
|
PH314458 | FGR MS Standard C13 and N15-labeled recombinant protein (NP_005239) |
CNY 19,520.00 |
|
TP761663 | Purified recombinant protein of uman Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog (FGR), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |