KIST (UHMK1) (NM_175866) Human Recombinant Protein
CAT#: TP314962
Recombinant protein of human U2AF homology motif (UHM) kinase 1 (UHMK1), 20 µg
View other "KIST" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214962 representing NM_175866
Red=Cloning site Green=Tags(s) MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_787062 |
Locus ID | 127933 |
UniProt ID | Q8TAS1 |
Refseq Size | 2901 |
Cytogenetics | 1q23.3 |
Refseq ORF | 1257 |
Synonyms | KIS; KIST; P-CIP2 |
Summary | The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406187 | UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC432915 | UHMK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406187 | Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1) |
CNY 4,840.00 |
|
LY432915 | Transient overexpression lysate of U2AF homology motif (UHM) kinase 1 (UHMK1), transcript variant 3 |
CNY 3,080.00 |
|
PH314962 | UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062) |
CNY 19,520.00 |