QK1 (QKI) (NM_206855) Human Recombinant Protein
CAT#: TP315788
Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4, 20 µg
View other "QK1" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215788 representing NM_206855
Red=Cloning site Green=Tags(s) MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGKFFSPWG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996737 |
Locus ID | 9444 |
UniProt ID | Q96PU8, Q8WY44 |
Refseq Size | 7919 |
Cytogenetics | 6q26 |
Refseq ORF | 957 |
Synonyms | Hqk; hqkI; QK; QK1; QK3 |
Summary | The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402025 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403718 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403730 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403731 | QKI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402025 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1 |
CNY 3,080.00 |
|
LY403718 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4 |
CNY 3,080.00 |
|
LY403730 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2 |
CNY 3,080.00 |
|
LY403731 | Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3 |
CNY 3,080.00 |
|
PH305779 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_006766) |
CNY 19,520.00 |
|
PH315734 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736) |
CNY 19,520.00 |
|
PH315788 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996737) |
CNY 19,520.00 |
|
PH324090 | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996735) |
CNY 19,520.00 |
|
TP305779 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315734 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP324090 | Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2, 20 µg |
CNY 2,900.00 |