United States
Germany
Japan
United Kingdom
China
HYAL1 (NM_033159) Human Recombinant Protein
CAT＃: TP316129
Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7, 20 µg
View other "HYAL1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216129 protein sequence
Red=Cloning site Green=Tags(s) MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC YPGWQAPWCERKSMW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_149349 |
| Locus ID | 3373 |
| UniProt ID | Q12794 |
| Refseq Size | 2103 |
| Cytogenetics | 3p21.31 |
| Refseq ORF | 1305 |
| Synonyms | HYAL-1; LUCA1; MPS9; NAT6 |
| Summary | This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
| Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402131 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407102 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407103 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409678 | HYAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY402131 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1 |
CNY 3,080.00 |
|
| LY407102 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 8 |
CNY 4,840.00 |
|
| LY407103 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 2 |
CNY 3,080.00 |
|
| LY409678 | Transient overexpression lysate of hyaluronoglucosaminidase 1 (HYAL1), transcript variant 7 |
CNY 4,840.00 |
|
| PH315525 | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_009296) |
CNY 19,520.00 |
|
| PH316129 | HYAL1 MS Standard C13 and N15-labeled recombinant protein (NP_149349) |
CNY 19,520.00 |
|
| TP315525 | Recombinant protein of human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP721049 | Purified recombinant protein of Human hyaluronoglucosaminidase 1 (HYAL1), transcript variant 5 |
CNY 3,140.00 |
