Cytohesin 1 (CYTH1) (NM_004762) Human Recombinant Protein
CAT#: TP316808
Recombinant protein of human cytohesin 1 (CYTH1), transcript variant 1, 20 µg
View other "Cytohesin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216808 protein sequence
Red=Cloning site Green=Tags(s) MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR KKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLN LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPT VERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKR RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004753 |
Locus ID | 9267 |
UniProt ID | Q15438 |
Refseq Size | 3366 |
Cytogenetics | 17q25.3 |
Refseq ORF | 1194 |
Synonyms | B2-1; CYTOHESIN-1; D17S811E; PSCD1; SEC7 |
Summary | The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413760 | CYTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417775 | CYTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413760 | Transient overexpression lysate of cytohesin 1 (CYTH1), transcript variant 2 |
CNY 3,080.00 |
|
LY417775 | Transient overexpression lysate of cytohesin 1 (CYTH1), transcript variant 1 |
CNY 3,080.00 |
|
PH316808 | CYTH1 MS Standard C13 and N15-labeled recombinant protein (NP_004753) |
CNY 19,520.00 |
其它Cytohesin 1产品