United States
Germany
Japan
United Kingdom
China
IL32 (NM_001012718) Human Recombinant Protein
CAT＃: TP317258
Recombinant protein of human interleukin 32 (IL32), transcript variant 8, 20 µg
View other "IL32" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217258 protein sequence
Red=Cloning site Green=Tags(s) MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELT PLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHA VQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.6 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001012736 |
| Locus ID | 9235 |
| UniProt ID | P24001 |
| Refseq Size | 1093 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 564 |
| Synonyms | IL-32alpha; IL-32beta; IL-32delta; IL-32gamma; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd |
| Summary | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401352 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422819 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422884 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422885 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422886 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422889 | IL32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401352 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 2 |
CNY 3,080.00 |
|
| LY422819 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 8 |
CNY 3,080.00 |
|
| LY422884 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 1 |
CNY 3,080.00 |
|
| LY422885 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 3 |
CNY 3,080.00 |
|
| LY422886 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 4 |
CNY 3,080.00 |
|
| LY422889 | Transient overexpression lysate of interleukin 32 (IL32), transcript variant 7 |
CNY 3,080.00 |
|
| PH316048 | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012651) |
CNY 19,520.00 |
|
| PH317258 | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736) |
CNY 19,520.00 |
|
| TP316048 | Recombinant protein of human interleukin 32 (IL32), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP761648 | Purified recombinant protein of Human interleukin 32 (IL32), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
