HIF1 beta (ARNT) (NM_178426) Human Recombinant Protein
CAT#: TP317284
Purified recombinant protein of Homo sapiens aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2, 20 µg
View other "HIF1 beta" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217284 representing NM_178426
Red=Cloning site Green=Tags(s) MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSND KERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK SLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLY DQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVN RLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848513 |
Locus ID | 405 |
UniProt ID | P27540 |
Refseq Size | 3563 |
Cytogenetics | 1q21.3 |
Refseq ORF | 984 |
Synonyms | aryl hydrocarbon receptor nuclear translocator; bHLHe2; dioxin receptor, nuclear translocator; HIF-1beta; HIF1B; HIF1BETA; hypoxia-inducible factor 1, beta subunit; OTTHUMP00000032943; TANGO |
Summary | This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400636 | ARNT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC405950 | ARNT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400636 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1 |
CNY 4,840.00 |
|
LY405950 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 2 |
CNY 3,080.00 |
|
PH316724 | ARNT MS Standard C13 and N15-labeled recombinant protein (NP_001659) |
CNY 19,520.00 |
|
PH317284 | ARNT MS Standard C13 and N15-labeled recombinant protein (NP_848513) |
CNY 14,250.00 |
|
TP316724 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator (ARNT), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它HIF1 beta产品