USP2 (NM_171997) Human Recombinant Protein
CAT#: TP317695
Recombinant protein of human ubiquitin specific peptidase 2 (USP2), transcript variant 2, 20 µg
View other "USP2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217695 representing NM_171997
Red=Cloning site Green=Tags(s) MRTSYTVTLPEDPPAAPFPALAKELRPRSPLSPSLLLSTFVGLLLNKAKNSKSAQGLAGLRNLGNTCFMN SILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPR FVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQL KSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKF SIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYT AYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_741994 |
Locus ID | 9099 |
UniProt ID | O75604, O75604-4 |
Refseq Size | 1378 |
Cytogenetics | 11q23.3 |
Refseq ORF | 1188 |
Synonyms | UBP41; USP9 |
Summary | This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401351 | USP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403527 | USP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401351 | Transient overexpression lysate of ubiquitin specific peptidase 2 (USP2), transcript variant 1 |
CNY 3,080.00 |
|
LY403527 | Transient overexpression lysate of ubiquitin specific peptidase 2 (USP2), transcript variant 2 |
CNY 3,080.00 |
|
PH317695 | USP2 MS Standard C13 and N15-labeled recombinant protein (NP_741994) |
CNY 19,520.00 |