United States
Germany
Japan
United Kingdom
China
CD200 (NM_001004196) Human Recombinant Protein
CAT＃: TP317941
Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg
View other "CD200" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217941 representing NM_001004196
Red=Cloning site Green=Tags(s) MERLTLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYT PASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLED EGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVT LSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI LLYWKRHRNQDREP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001004196 |
| Locus ID | 4345 |
| UniProt ID | P41217 |
| Refseq Size | 2247 |
| Cytogenetics | 3q13.2 |
| Refseq ORF | 882 |
| Synonyms | MOX1; MOX2; MRC; OX-2 |
| Summary | This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401799 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424074 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401799 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 |
CNY 3,080.00 |
|
| LY424074 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 |
CNY 3,080.00 |
|
| PH306356 | CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935) |
CNY 19,520.00 |
|
| PH317941 | CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196) |
CNY 14,250.00 |
|
| TP306356 | Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP724003 | Human CD200 Protein, His Tag |
CNY 4,925.00 |
