Collagen IX (COL9A1) (NM_001851) Human Recombinant Protein
CAT#: TP318130
Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 1, 20 µg
View other "Collagen IX" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218130 representing NM_001851
Red=Cloning site Green=Tags(s) MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAAS RRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKE QVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRG PIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPP GPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPG SRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRS GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDG EPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGK PGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGEL GPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPG PKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVI QEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK GERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQA GQRAFNKGPDP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 89.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001842 |
Locus ID | 1297 |
UniProt ID | P20849 |
Refseq Size | 3704 |
Cytogenetics | 6q13 |
Refseq ORF | 2763 |
Synonyms | DJ149L1.1.2; EDM6; MED; STL4 |
Summary | This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A SMOC2 variant inhibits BMP signaling by competitively binding to BMPR1B and causes growth plate defects
,Long, F;Shi, H;Li, P;Guo, S;Ma, Y;Wei, S;Li, Y;Gao, F;Gao, S;Wang, M;Duan, R;Wang, X;Yang, K;Sun, W;Li, X;Li, J;Liu, Q;,
Bone
,PubMed ID 33059102
[COL9A1]
|
A variant in SMOC2, inhibiting BMP signaling by competitively binding to BMPR1B, causes multiple epiphyseal dysplasia
,Long, F;Li, L;Shi, H;Li, P;Guo, S;Ma, Y;Li, Y;Wei, S;,
BioRxiv
[COL9A1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409192 | COL9A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419709 | COL9A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409192 | Transient overexpression lysate of collagen, type IX, alpha 1 (COL9A1), transcript variant 2 |
CNY 3,080.00 |
|
LY419709 | Transient overexpression lysate of collagen, type IX, alpha 1 (COL9A1), transcript variant 1 |
CNY 4,840.00 |
|
PH309473 | COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_511040) |
CNY 14,250.00 |
|
PH318130 | COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_001842) |
CNY 19,520.00 |
|
TP309473 | Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Collagen IX产品