United States
Germany
Japan
United Kingdom
China
Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein
CAT＃: TP318982
Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta, 20 µg
View other "Caspase 1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218982 representing NM_033294
Red=Cloning site Green=Tags(s) MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTR LALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLV FMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIG RLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_150636 |
| Locus ID | 834 |
| UniProt ID | P29466 |
| Refseq Size | 941 |
| Cytogenetics | 11q22.3 |
| Refseq ORF | 789 |
| Synonyms | ICE; IL1BC; P45 |
| Summary | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409612 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409613 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420065 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429054 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409612 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant gamma |
CNY 3,080.00 |
|
| LY409613 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta |
CNY 3,080.00 |
|
| LY420065 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant beta |
CNY 3,080.00 |
|
| PH318982 | CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636) |
CNY 19,520.00 |
|
| TP760190 | Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP761213 | Purified recombinant protein of -Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP762669 | Purified recombinant protein of Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha |
CNY 2,480.00 |
其它Caspase 1产品
