GAB1 (NM_002039) Human Recombinant Protein
CAT#: TP319005
Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 2, 20 µg
View other "GAB1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219005 representing NM_002039
Red=Cloning site Green=Tags(s) MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDA GLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTEEDPVKPPGSSLQAPADLPL AINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINCQSKKPEPTRTHADSAKSTSSE TDCNDNVPSHKNPASSQSKHGMNGFFQQQMIYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEA DGELYVFNTPSGTSSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHP AHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVP PPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARD SSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 76.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002030 |
Locus ID | 2549 |
UniProt ID | Q13480 |
Refseq Size | 3323 |
Cytogenetics | 4q31.21 |
Refseq ORF | 2082 |
Synonyms | DFNB26 |
Summary | The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome |
Protein Pathways | ErbB signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400746 | GAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404056 | GAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400746 | Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 2 |
CNY 4,840.00 |
|
LY404056 | Transient overexpression lysate of GRB2-associated binding protein 1 (GAB1), transcript variant 1 |
CNY 3,080.00 |
|
PH309622 | GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_997006) |
CNY 19,520.00 |
|
PH319005 | GAB1 MS Standard C13 and N15-labeled recombinant protein (NP_002030) |
CNY 19,520.00 |
|
TP309622 | Recombinant protein of human GRB2-associated binding protein 1 (GAB1), transcript variant 1, 20 µg |
CNY 2,900.00 |