Calcipressin 1 (RCAN1) (NM_004414) Human Recombinant Protein
CAT#: TP320434
Recombinant protein of human regulator of calcineurin 1 (RCAN1), transcript variant 1, 20 µg
View other "Calcipressin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220434 representing NM_004414
Red=Cloning site Green=Tags(s) MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIA CHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYF AQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPS VVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004405 |
Locus ID | 1827 |
UniProt ID | P53805 |
Refseq Size | 2457 |
Cytogenetics | 21q22.12 |
Refseq ORF | 756 |
Synonyms | ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1 |
Summary | The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403714 | RCAN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403714 | Transient overexpression lysate of regulator of calcineurin 1 (RCAN1), transcript variant 3 |
CNY 3,080.00 |
|
PH320434 | RCAN1 MS Standard C13 and N15-labeled recombinant protein (NP_004405) |
CNY 14,250.00 |
|
TP760488 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP760720 | Purified recombinant protein of Human regulator of calcineurin 1 (RCAN1), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Calcipressin 1产品