DNAJB12 (NM_017626) Human Recombinant Protein
CAT#: TP320679
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2, 20 µg
View other "DNAJB12" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220679 protein sequence
Red=Cloning site Green=Tags(s) MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHAT HRKAGGTDAPSANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPD KNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGG GFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV GHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTD MYHRAQKMGTPSCSRLSEVQASLHG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060096 |
Locus ID | 54788 |
UniProt ID | Q9NXW2 |
Refseq Size | 3215 |
Cytogenetics | 10q22.1 |
Refseq ORF | 1125 |
Synonyms | DJ10 |
Summary | DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413670 | DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432222 | DNAJB12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413670 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 |
CNY 3,080.00 |
|
LY432222 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 12 (DNAJB12), transcript variant 2 |
CNY 3,080.00 |
|
PH320679 | DNAJB12 MS Standard C13 and N15-labeled recombinant protein (NP_060096) |
CNY 19,520.00 |
其它DNAJB12产品