United States
Germany
Japan
United Kingdom
China
NUMB (NM_001005743) Human Recombinant Protein
CAT＃: TP320960
Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 1, 20 µg
View other "NUMB" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220960 representing NM_001005743
Red=Cloning site Green=Tags(s) MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAKREEIM KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR TNPSPTNPFSSDLQKTFEIEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 70.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001005743 |
| Locus ID | 8650 |
| UniProt ID | P49757 |
| Refseq Size | 3647 |
| Cytogenetics | 14q24.2-q24.3 |
| Refseq ORF | 1953 |
| Synonyms | C14orf41; c14_5527; S171 |
| Summary | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Protein Pathways | Notch signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401229 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC423643 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC423644 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY401229 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 3 |
CNY 4,840.00 |
|
| LY423643 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 1 |
CNY 4,840.00 |
|
| LY423644 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 2 |
CNY 4,840.00 |
|
| PH320960 | NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005743) |
CNY 19,520.00 |
|
| PH321018 | NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005744) |
CNY 19,520.00 |
|
| TP321018 | Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP710054 | Recombinant protein of human numb homolog (Drosophila)(MUMB),residues 1-603aa, with C-terminal flag tag,expressed in sf9 cells |
CNY 4,020.00 |
|
| TP761513 | Purified recombinant protein of Human numb homolog (Drosophila) (NUMB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
